PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00404g00810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 391aa    MW: 43764.2 Da    PI: 7.1533
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00404g00810.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.77e-304494151
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                              kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQ
  Peaxi162Scf00404g00810.1 44 KPRLKWTPDLHERFIEAVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQ 94
                              79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.47841101IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-274294IPR009057Homeodomain-like
SuperFamilySSF466892.15E-1443100IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-224499IPR006447Myb domain, plants
PfamPF002499.2E-94694IPR001005SANT/Myb domain
PfamPF143792.9E-24155202IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MYHRHHQVKM MHHSSRMSIP ERQLFLQSGN TSGDSGLVLS TDAKPRLKWT PDLHERFIEA  60
VNQLGGADKA TPKSVLKLMG IQGLTLYHLK SHLQVSFIHL ISSFNKSKYR LSKNLHGQAI  120
ANGVSKAVTA VENIPETTGT QLHAPNIGTQ PNKNIQISEA IQMQIEVQRR LHEQLEVQRH  180
LQLRIEAQGK YLQAVLEKAQ ETLGRQNLGT IGLEAAKVQL SELVSKVSNQ CLSSTLSEIK  240
EISGFHPADC SMDSCLTSCD EIHTNHGLRP LSFTPSNDIA TETLRWCDDL KENKSFFDHE  300
DKEKVLFSKE SNHCSNLSMS IGLEGSGKWN DYNSSDGRLN LIATKSDSMK PEKKQNSTSS  360
QEYKLDLNTD DETIDAATSN KQFDLNGFSW N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770704.11e-178PREDICTED: uncharacterized protein LOC104221350 isoform X1
RefseqXP_016516111.11e-178PREDICTED: uncharacterized protein LOC107832752 isoform X1
TrEMBLM1AFH51e-169M1AFH5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000216531e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-117G2-like family protein